Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIDA Peptide - N-terminal region

AIDA Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf80, FLJ12806, FLJ32421, RP11-378J18.7

UniProt

Q96BJ3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AIDA Rabbit Polyclonal Antibody (orb585517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073742

Preservative

Lyophilized powder

AA Sequence

WGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human 14-3-3 eta/YWHAH Protein (GST Tag)
PKSH031391 100 µg

Recombinant Human 14-3-3 eta/YWHAH Protein (GST Tag)

Sign In for Pricing
View Details
3,5-Dioxocyclohexanecarboxylic Acid
TRC-D486373-5G 5 g

3,5-Dioxocyclohexanecarboxylic Acid

Sign In for Pricing
View Details
PCDHGB2 (NM_032096) Human Recombinant Protein
TP311028 20 µg

PCDHGB2 (NM_032096) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS808436 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS707488 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), 0.2mg/mL
BNUB2206-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), 0.2mg/mL

Sign In for Pricing
View Details