Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIDA Peptide - N-terminal region

AIDA Peptide - N-terminal region

Product Specifications

Product Name Alternative

C1orf80, FLJ12806, FLJ32421, RP11-378J18.7

UniProt

Q96BJ3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AIDA Rabbit Polyclonal Antibody (orb585517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073742

Preservative

Lyophilized powder

AA Sequence

WGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hydroxypyridine-2-thione Zinc
TRC-H249820-1G 1 g

1-Hydroxypyridine-2-thione Zinc

Sign In for Pricing
View Details
VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®680 SE
#92160 1 Kit

VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®680 SE

Sign In for Pricing
View Details
p-Nitrophenyl b-D-Lactopyranoside
TRC-N503850-500MG 500 mg

p-Nitrophenyl b-D-Lactopyranoside

Sign In for Pricing
View Details
6-Chloro-1-hexanol
TRC-C367475-25G 25 g

6-Chloro-1-hexanol

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706131 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Trim9 Mouse Gene Knockout Kit (CRISPR)
KN518243 1 Kit

Trim9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details