Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK2 Peptide - middle region

AK2 Peptide - middle region

Product Specifications

Product Name Alternative

ADK2, AK 2

UniProt

P54819

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AK2 Rabbit Polyclonal Antibody (orb579647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001616

Preservative

Lyophilized powder

AA Sequence

LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT2 Inhibitor
1857-25 25 mg

SIRT2 Inhibitor

Sign In for Pricing
View Details
N-Nitroso Omeprazol
CS-O-58709 1 Each

N-Nitroso Omeprazol

Sign In for Pricing
View Details
Recombinant Ornithine Transcarbamylase (OTC)
TRV-0012223-01 10 µg

Recombinant Ornithine Transcarbamylase (OTC)

Sign In for Pricing
View Details
Recombinant Ornithine Transcarbamylase (OTC)
TRV-0012223-02 50 µg

Recombinant Ornithine Transcarbamylase (OTC)

Sign In for Pricing
View Details
Recombinant Ornithine Transcarbamylase (OTC)
TRV-0012223-03 100 µg

Recombinant Ornithine Transcarbamylase (OTC)

Sign In for Pricing
View Details
Recombinant Ornithine Transcarbamylase (OTC)
TRV-0012223-04 200 µg

Recombinant Ornithine Transcarbamylase (OTC)

Sign In for Pricing
View Details