AK2 Peptide - middle region
AK2 Peptide - middle region
Product Specifications
Product Name Alternative
ADK2, AK 2
UniProt
P54819
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AK2 Rabbit Polyclonal Antibody (orb579647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001616
Preservative
Lyophilized powder
AA Sequence
LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2909685-01 20 µg
Recombinant Schizosaccharomyces pombe Zinc homeostasis factor 1 (zhf1)
Sign In for Pricing
View Details orb2909685-02 100 µg
Recombinant Schizosaccharomyces pombe Zinc homeostasis factor 1 (zhf1)
Sign In for Pricing
View Details 
043326-ML550 100 µL
TSC1, phosphorylated (T310) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 550) discontinued
Sign In for Pricing
View Details 