Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK5 Peptide - N-terminal region

AK5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AK6, MGC33326

UniProt

Q9Y6K8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AK5 Rabbit Polyclonal Antibody (orb582505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777283

Preservative

Lyophilized powder

AA Sequence

ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HARS1 (NM_002109) Human Over-expression Lysate
LC419527 20 µg

HARS1 (NM_002109) Human Over-expression Lysate

Sign In for Pricing
View Details
DL-2,4-Diaminobutyric Acid Dihydrochloride
TRC-D453553-10MG 10 mg

DL-2,4-Diaminobutyric Acid Dihydrochloride

Sign In for Pricing
View Details
NUDT19 (NM_001105570) Human Recombinant Protein
TP325574L 1 mg

NUDT19 (NM_001105570) Human Recombinant Protein

Sign In for Pricing
View Details
Human MIγ/CXCL9 Antibody Pair Set
E-KAB-0525 50 µL & 100 µg

Human MIγ/CXCL9 Antibody Pair Set

Sign In for Pricing
View Details
Sri (BC065790) Mouse Tagged ORF Clone
MG201972 10 µg

Sri (BC065790) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SUPT5H (NM_001130824) Human Recombinant Protein
TP326322L 1 mg

SUPT5H (NM_001130824) Human Recombinant Protein

Sign In for Pricing
View Details