AKAP10 Peptide - middle region
AKAP10 Peptide - middle region
Product Specifications
Product Name Alternative
D-AKAP2, MGC9414, PRKA10
UniProt
O43572
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKAP10 Rabbit Polyclonal Antibody (orb329866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009133
Preservative
Lyophilized powder
AA Sequence
ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2527986 100 µL
Phospho-HER4 (Tyr1056) Rabbit Polyclonal Antibody (BF555)
Sign In for Pricing
View Details RC220377L1 10 µg
Glucocorticoid Receptor (NR3C1) (NM_001020825) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 135048-FITC 100 µL
UCHL3 (Ubiquitin Carboxyl-terminal Hydrolase Isozyme L3, UCH-L3, Ubiquitin thioesterase L3) (FITC)
Sign In for Pricing
View Details