Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP8L Peptide - middle region

AKAP8L Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434L0650, HA95, HAP95, NAKAP, NAKAP95

UniProt

Q9ULX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKAP8L Rabbit Polyclonal Antibody (orb329673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055186

Preservative

Lyophilized powder

AA Sequence

ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bif (SH3GLB1) Human Gene Knockout Kit (CRISPR)
KN400106 1 Kit

Bif (SH3GLB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBC1D2 Polyclonal Antibody
E-AB-52646-01 20 µL

TBC1D2 Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D2 Polyclonal Antibody
E-AB-52646-02 60 µL

TBC1D2 Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D2 Polyclonal Antibody
E-AB-52646-03 120 µL

TBC1D2 Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D2 Polyclonal Antibody
E-AB-52646-04 200 µL

TBC1D2 Polyclonal Antibody

Sign In for Pricing
View Details
PE(P-18:0_18:1)+H
TRC-P282820-25MG 25 mg

PE(P-18:0_18:1)+H

Sign In for Pricing
View Details