Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP8L Peptide - middle region

AKAP8L Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434L0650, HA95, HAP95, NAKAP, NAKAP95

UniProt

Q9ULX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKAP8L Rabbit Polyclonal Antibody (orb329673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055186

Preservative

Lyophilized powder

AA Sequence

ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BET1 Rabbit Polyclonal Antibody
TA373996 100 µL

BET1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
17Alpha-Boldenone-d3 17-O-(4-Nitrobenzoate)
TRC-B675132-25MG 25 mg

17Alpha-Boldenone-d3 17-O-(4-Nitrobenzoate)

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559414 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
5-Oxomefruside
TRC-O857850-1MG 1 mg

5-Oxomefruside

Sign In for Pricing
View Details
Human EOLA1 activation kit by CRISPRa
GA114171 1 Kit

Human EOLA1 activation kit by CRISPRa

Sign In for Pricing
View Details
Protein G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB09F2-PG 10x 96 Well Plates

Protein G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details