AKR1C3 Peptide - N-terminal region
AKR1C3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, KIAA0119, hluPGFS
UniProt
P42330
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKR1C3 Rabbit Polyclonal Antibody (orb331134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003730
Preservative
Lyophilized powder
AA Sequence
PALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680204-500 1x 500 µL
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400029-500 1x 500 µL
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details