Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alad Peptide - N-terminal region

Alad Peptide - N-terminal region

Product Specifications

Product Name Alternative

Lv

UniProt

P10518

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Alad Rabbit Polyclonal Antibody (orb578145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032551

Preservative

Lyophilized powder

AA Sequence

MHHQSVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA1A Antibody
KC-1255-01 50 μL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-1255-02 100 µL

HSPA1A Antibody

Sign In for Pricing
View Details
HSPA1A Antibody
KC-1255-03 1 mL

HSPA1A Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708259 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
DNAJB6 Antibody
OC-141-01 50 μL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
OC-141-02 100 µL

DNAJB6 Antibody

Sign In for Pricing
View Details