Alad Peptide - N-terminal region
Alad Peptide - N-terminal region
Product Specifications
Product Name Alternative
Lv
UniProt
P10518
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Alad Rabbit Polyclonal Antibody (orb578145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032551
Preservative
Lyophilized powder
AA Sequence
MHHQSVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743058-100 1x 100 µL
Cytochrome P450 3A1 / CYP3A1 (P6), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942956-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY429136 100 µg
TGIF (TGIF1) (NM_003244) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC042554-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 