Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALAD Peptide - N-terminal region

ALAD Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALADH, MGC5057, PBGS

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALAD Rabbit Polyclonal Antibody (orb578243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003945

Preservative

Lyophilized powder

AA Sequence

MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBB4Q (TUBB7P) (NM_020040) Human Recombinant Protein
TP314345M 100 µg

TUBB4Q (TUBB7P) (NM_020040) Human Recombinant Protein

Sign In for Pricing
View Details
Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-M0009-01 10x 96 Tests

Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-M0009-02 5x 96 Tests

Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-M0009-03 96 Tests

Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR561730 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712773 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details