Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALAD Peptide - N-terminal region

ALAD Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALADH, MGC5057, PBGS

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALAD Rabbit Polyclonal Antibody (orb578243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003945

Preservative

Lyophilized powder

AA Sequence

MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin PLP Recombinant Chimeric Antibody Antibody
HA601469 100 µL

Myelin PLP Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
5-(2-Nitro-1-propenyl)-1,3-benzodioxole
TRC-N519705-1G 1 g

5-(2-Nitro-1-propenyl)-1,3-benzodioxole

Sign In for Pricing
View Details
alpha,alpha-Difluoro-3-nitrobenzeneacetic Acid
TRC-D302590-500MG 500 mg

alpha,alpha-Difluoro-3-nitrobenzeneacetic Acid

Sign In for Pricing
View Details
Recombinant STK4 Antibody
RN-13650-01 50 μL

Recombinant STK4 Antibody

Sign In for Pricing
View Details
Recombinant STK4 Antibody
RN-13650-02 100 µL

Recombinant STK4 Antibody

Sign In for Pricing
View Details
Recombinant STK4 Antibody
RN-13650-03 1 mL

Recombinant STK4 Antibody

Sign In for Pricing
View Details