Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A2 Peptide - N-terminal region

ALDH1A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC26444, RALDH (II), RALDH2, RALDH2-T

UniProt

O94788

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A2 Rabbit Polyclonal Antibody (orb331069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003879

Preservative

Lyophilized powder

AA Sequence

PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apster impurity 51 (Standard)
HY-Z0532R 1 Each

Apster impurity 51 (Standard)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPBP35G2.04c Protein (aa 1-249)
VAng-Yyj6538-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe SPBP35G2.04c Protein (aa 1-249)

Sign In for Pricing
View Details
MANBAL (NM_001003897) Human Over-expression Lysate
LC424033 20 µg

MANBAL (NM_001003897) Human Over-expression Lysate

Sign In for Pricing
View Details
PD1 Detection Set (Risk Free)
orb1227446 1 Each

PD1 Detection Set (Risk Free)

Sign In for Pricing
View Details
N-Formyl Rifuzole
TRC-F700958-10MG 10 mg

N-Formyl Rifuzole

Sign In for Pricing
View Details
Orexin A (Human, Rat, Mouse, Porcine, Ovine, Bovine, Monkey) - Rhodamine Labeled
FR-003-30 1 nmol

Orexin A (Human, Rat, Mouse, Porcine, Ovine, Bovine, Monkey) - Rhodamine Labeled

Sign In for Pricing
View Details