Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A2 Peptide - N-terminal region

ALDH1A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC26444, RALDH (II), RALDH2, RALDH2-T

UniProt

O94788

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1A2 Rabbit Polyclonal Antibody (orb331069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003879

Preservative

Lyophilized powder

AA Sequence

PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHYHD1 Human shRNA Lentiviral Particle (Locus ID 254295)
TL302498V 500 µL Each

PHYHD1 Human shRNA Lentiviral Particle (Locus ID 254295)

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-01 50 μL

CYTH3 Antibody

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-02 100 µL

CYTH3 Antibody

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-03 1 mL

CYTH3 Antibody

Sign In for Pricing
View Details
RAB27B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV683845 1.0 µg DNA

RAB27B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Box of 100 Glass Microfibre Filter 0.7µm, 47 Mm
FV25A0047C Box of 100

Box of 100 Glass Microfibre Filter 0.7µm, 47 Mm

Sign In for Pricing
View Details