Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A1 Peptide - N-terminal region

ALDH3A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDH3, ALDHIII, MGC10406

UniProt

P30838

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3A1 Rabbit Polyclonal Antibody (orb331065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_000682

Preservative

Lyophilized powder

AA Sequence

DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Antichymotrypsin (SERPINA3) Mouse Monoclonal Antibody [Clone ID: B2B3]
AM26406PU-L 500 µg

alpha 1 Antichymotrypsin (SERPINA3) Mouse Monoclonal Antibody [Clone ID: B2B3]

Sign In for Pricing
View Details
Trk receptor Antibody
orb3169706-01 1 mg

Trk receptor Antibody

Sign In for Pricing
View Details
Trk receptor Antibody
orb3169706-02 5 mg

Trk receptor Antibody

Sign In for Pricing
View Details
Trk receptor Antibody
orb3169706-03 10 mg

Trk receptor Antibody

Sign In for Pricing
View Details
Bovine High mobility group nucleosome-binding domain-containing protein 4, HMGN4 ELISA Kit
MBS9335246-01 48 Well

Bovine High mobility group nucleosome-binding domain-containing protein 4, HMGN4 ELISA Kit

Sign In for Pricing
View Details
Bovine High mobility group nucleosome-binding domain-containing protein 4, HMGN4 ELISA Kit
MBS9335246-02 96 Well

Bovine High mobility group nucleosome-binding domain-containing protein 4, HMGN4 ELISA Kit

Sign In for Pricing
View Details