Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Peptide - C-terminal region

ALDH3B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3B2 Rabbit Polyclonal Antibody (orb585414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000686

Preservative

Lyophilized powder

AA Sequence

LLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TrkC/NTRK3 Protein (His & Fc Tag)
PKSH031916 100 µg

Recombinant Human TrkC/NTRK3 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS626833 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), Biotin conjugate, 0.1mg/mL
BNCB2340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Salicylaldehyde
TRC-S088145-10G 10 g

Salicylaldehyde

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP2 (DCT) Human Gene Knockout Kit (CRISPR)
KN204486RB 1 Kit

TRP2 (DCT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details