Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Peptide - C-terminal region

ALDH3B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3B2 Rabbit Polyclonal Antibody (orb585414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000686

Preservative

Lyophilized powder

AA Sequence

LLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3227), CF405S conjugate, 0.1mg/mL
BNC043227-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3227), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bis(4-nitrophenyl) Phenyl Phosphate
TRC-B596460-1G 1 g

Bis(4-nitrophenyl) Phenyl Phosphate

Sign In for Pricing
View Details
Sodium 1-Propanethiolate (Technical Grade)
TRC-S673280-250MG 250 mg

Sodium 1-Propanethiolate (Technical Grade)

Sign In for Pricing
View Details
ANKH (NM_054027) Human Over-expression Lysate
LC403292 20 µg

ANKH (NM_054027) Human Over-expression Lysate

Sign In for Pricing
View Details
Sodium 1-Pentanesulfonate Monohydrate
TRC-S655050-25G 25 g

Sodium 1-Pentanesulfonate Monohydrate

Sign In for Pricing
View Details
MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E11]
TA505749BM 100 µL

MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details