Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Peptide - N-terminal region

ALDH3B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3B2 Rabbit Polyclonal Antibody (orb585415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000686

Preservative

Lyophilized powder

AA Sequence

LTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldolase C Recombinant Rabbit Monoclonal Antibody [PSH01-82]
HA721734 100 µL

Aldolase C Recombinant Rabbit Monoclonal Antibody [PSH01-82]

Sign In for Pricing
View Details
Des-(Cyclohexa-2,5-dien-1-one) Androsta-(E)-3-oxobut-1-en-1-yl-2,3,4-13C3)
TRC-D695434-0.5MG 0.5 mg

Des-(Cyclohexa-2,5-dien-1-one) Androsta-(E)-3-oxobut-1-en-1-yl-2,3,4-13C3)

Sign In for Pricing
View Details
Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate
LY432690 100 µg

Endothelin 1 (EDN1) (NM_001168319) Human Over-expression Lysate

Sign In for Pricing
View Details
HCK (NM_001172130) Human Over-expression Lysate
LY433231 100 µg

HCK (NM_001172130) Human Over-expression Lysate

Sign In for Pricing
View Details
Utp23 Mouse Gene Knockout Kit (CRISPR)
KN518827 1 Kit

Utp23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD302/CLEC13A Protein (Fc Tag)
PKSM040534 100 µg

Recombinant Mouse CD302/CLEC13A Protein (Fc Tag)

Sign In for Pricing
View Details