Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3B2 Peptide - N-terminal region

ALDH3B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDH8

UniProt

P48448

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH3B2 Rabbit Polyclonal Antibody (orb585415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000686

Preservative

Lyophilized powder

AA Sequence

LTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromo Polystyrene
H50056009.100G 100 g

Bromo Polystyrene

Sign In for Pricing
View Details
(R)-Usnic acid Sodium
TRC-U850155-100MG 100 mg

(R)-Usnic acid Sodium

Sign In for Pricing
View Details
QPCT antibody
FNab09917 100 µg

QPCT antibody

Sign In for Pricing
View Details
DLX5 Rabbit Polyclonal Antibody
AP20392PU-N 100 µg

DLX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XFD610 azide
70064-AAT 1 mg

XFD610 azide

Sign In for Pricing
View Details
Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
TA500758AM 100 µL

Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details