Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh4a1 Peptide - N-terminal region

Aldh4a1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aldh4a1

UniProt

P0C2X9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aldh4a1 Rabbit Polyclonal Antibody (orb579543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128170

Preservative

Lyophilized powder

AA Sequence

GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC Conjugate - Biotium Choice
P015-APC-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC Conjugate - Biotium Choice

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS809274 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS504957 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
DL-3-Phenylserine Hydrate
TRC-P319385-500MG 500 mg

DL-3-Phenylserine Hydrate

Sign In for Pricing
View Details
Human SLCO3A1 activation kit by CRISPRa
GA109156 1 Kit

Human SLCO3A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Rat Cystatin C Protein (Trx Tag)
PDER100129-01 20 µg

Recombinant Rat Cystatin C Protein (Trx Tag)

Sign In for Pricing
View Details