Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh4a1 Peptide - N-terminal region

Aldh4a1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aldh4a1

UniProt

P0C2X9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aldh4a1 Rabbit Polyclonal Antibody (orb579543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128170

Preservative

Lyophilized powder

AA Sequence

GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

uLK4 (NM_017886) Human Recombinant Protein
TP323647M 100 µg

uLK4 (NM_017886) Human Recombinant Protein

Sign In for Pricing
View Details
Proteasome beta 1 (PSMB1) Human Gene Knockout Kit (CRISPR)
KN401798 1 Kit

Proteasome beta 1 (PSMB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF488A conjugate, 0.1mg/mL
BNC883074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITGB6 Rabbit Polyclonal Antibody
TA364495 100 µL

ITGB6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody
AP51044PU-N 400 µL

Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sfr274I, 500U
RE1332 500 U

Sfr274I, 500U

Sign In for Pricing
View Details