Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH5A1 Peptide - middle region

ALDH5A1 Peptide - middle region

Product Specifications

Product Name Alternative

SSADH, SSDH

UniProt

P51649

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH5A1 Rabbit Polyclonal Antibody (orb584387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001071

Preservative

Lyophilized powder

AA Sequence

AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal GDF-8/Myostatin Antibody (RM0243-13F2) [Allophycocyanin]
NBP2-12334APC 0.1 mL

Rat Monoclonal GDF-8/Myostatin Antibody (RM0243-13F2) [Allophycocyanin]

Sign In for Pricing
View Details
Epothilone D
orb1679023-01 5 mg

Epothilone D

Sign In for Pricing
View Details
Epothilone D
orb1679023-02 1 mg

Epothilone D

Sign In for Pricing
View Details
Cholesterol Impurity 37
RM-H041837-01 10 mg

Cholesterol Impurity 37

Sign In for Pricing
View Details
Cholesterol Impurity 37
RM-H041837-02 25 mg

Cholesterol Impurity 37

Sign In for Pricing
View Details
Cholesterol Impurity 37
RM-H041837-03 50 mg

Cholesterol Impurity 37

Sign In for Pricing
View Details