Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH5A1 Peptide - middle region

ALDH5A1 Peptide - middle region

Product Specifications

Product Name Alternative

SSADH, SSDH

UniProt

P51649

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH5A1 Rabbit Polyclonal Antibody (orb584387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001071

Preservative

Lyophilized powder

AA Sequence

AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Pleiotrophin (PTN) ELISA Kit
RDR-PTN-b-96Tests 96 Tests

Bovine Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
Pbx 2 (1.1) FITC
sc-101853 FITC 200 µg/mL

Pbx 2 (1.1) FITC

Sign In for Pricing
View Details
Substance P
4010600.0025 25 mg

Substance P

Sign In for Pricing
View Details
MIS12 siRNA (Mouse)
MBS829418-01 15 nmol

MIS12 siRNA (Mouse)

Sign In for Pricing
View Details
MIS12 siRNA (Mouse)
MBS829418-02 30 nmol

MIS12 siRNA (Mouse)

Sign In for Pricing
View Details
MIS12 siRNA (Mouse)
MBS829418-03 5x 30 nmol

MIS12 siRNA (Mouse)

Sign In for Pricing
View Details