Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG5 Peptide - N-terminal region

ALG5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP11-421P11.2, bA421P11.2

UniProt

Q9Y673

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG5 Rabbit Polyclonal Antibody (orb326404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037470

Preservative

Lyophilized powder

AA Sequence

ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YUM70
C11697-25mg 25 mg

YUM70

Sign In for Pricing
View Details
ARMCX6 siRNA (Rat)
CRR6202-01 15 nmol

ARMCX6 siRNA (Rat)

Sign In for Pricing
View Details
ARMCX6 siRNA (Rat)
CRR6202-02 30 nmol

ARMCX6 siRNA (Rat)

Sign In for Pricing
View Details
Sctr 3'UTR Luciferase Stable Cell Line
TU118446 1.0 mL

Sctr 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (HRP)
249023-HRP 100 µL

MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming, MLP, SMUC) (HRP)

Sign In for Pricing
View Details
Cdk4, p34 (CDK4, Cyclin-dependent Kinase 4, p34cdk4) (APC)
C2574-10-APC 100 µL

Cdk4, p34 (CDK4, Cyclin-dependent Kinase 4, p34cdk4) (APC)

Sign In for Pricing
View Details