Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG5 Peptide - N-terminal region

ALG5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP11-421P11.2, bA421P11.2

UniProt

Q9Y673

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG5 Rabbit Polyclonal Antibody (orb326404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037470

Preservative

Lyophilized powder

AA Sequence

ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antioxidant Peptide [Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu]
A2298-45A 1 mg

Antioxidant Peptide [Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu]

Sign In for Pricing
View Details
C2orf88 Human Over-expression Lysate
orb1364290 20 µg

C2orf88 Human Over-expression Lysate

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) Human Over-expression Lysate
orb1358504 100 µg

Carbonic Anhydrase I (CA1) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC688428 3'UTR Luciferase Stable Cell Line
TU211707 1.0 mL

LOC688428 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Nei Endonuclease VIII Like Protein 3 (NEIL3)
TRV-0014028-01 10 µg

Recombinant Nei Endonuclease VIII Like Protein 3 (NEIL3)

Sign In for Pricing
View Details
Recombinant Nei Endonuclease VIII Like Protein 3 (NEIL3)
TRV-0014028-02 50 µg

Recombinant Nei Endonuclease VIII Like Protein 3 (NEIL3)

Sign In for Pricing
View Details