Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH1 Peptide - N-terminal region

ALKBH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABH, ABH1, ALKBH, alkB, hABH

UniProt

Q13686

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALKBH1 Rabbit Polyclonal Antibody (orb585128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006011

Preservative

Lyophilized powder

AA Sequence

PGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARPP32 (PPP1R1B) (NM_181505) Human Over-expression Lysate
LY405677 100 µg

DARPP32 (PPP1R1B) (NM_181505) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified
MBS3907713-01 0.001 mg

Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified
MBS3907713-02 0.01 mg

Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified
MBS3907713-03 5x 0.001 mg

Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified
MBS3907713-04 5x 0.01 mg

Rabbit anti-ZBTB40 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
EDC3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0653202 1.0 µg DNA

EDC3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details