Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2 Peptide - middle region

ALS2 Peptide - middle region

Product Specifications

Product Name Alternative

ALS2CR6, ALSJ, FLJ31851, IAHSP, KIAA1563, MGC87187, PLSJ

UniProt

Q96Q42

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2 Rabbit Polyclonal Antibody (orb583578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065970

Preservative

Lyophilized powder

AA Sequence

ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC2 Protein Lysate
OCOA00895-20UG 20 µg

PSMC2 Protein Lysate

Sign In for Pricing
View Details
CLCA4 siRNA (Human)
orb1860477-01 15 nmol

CLCA4 siRNA (Human)

Sign In for Pricing
View Details
CLCA4 siRNA (Human)
orb1860477-02 30 nmol

CLCA4 siRNA (Human)

Sign In for Pricing
View Details
One Step TUNEL Apoptosis Assay Kit, Universal
EBA2420 20 Assays

One Step TUNEL Apoptosis Assay Kit, Universal

Sign In for Pricing
View Details
TMEM41A Antibody, HRP conjugated
CSB-PA023837LB01HU-01 50 µg

TMEM41A Antibody, HRP conjugated

Sign In for Pricing
View Details
TMEM41A Antibody, HRP conjugated
CSB-PA023837LB01HU-02 100 µg

TMEM41A Antibody, HRP conjugated

Sign In for Pricing
View Details