Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2 Peptide - middle region

ALS2 Peptide - middle region

Product Specifications

Product Name Alternative

ALS2CR6, ALSJ, FLJ31851, IAHSP, KIAA1563, MGC87187, PLSJ

UniProt

Q96Q42

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2 Rabbit Polyclonal Antibody (orb583578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065970

Preservative

Lyophilized powder

AA Sequence

ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin, Mr 53,000
62205 100 µg

Desmin, Mr 53,000

Sign In for Pricing
View Details
Anti-V5 Antibody
18870 1mg

Anti-V5 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TAF9b Antibody
NBP3-29792 100 µg

Rabbit Polyclonal TAF9b Antibody

Sign In for Pricing
View Details
ASGR1 Polyclonal Antibody
E916766 100 µL

ASGR1 Polyclonal Antibody

Sign In for Pricing
View Details
Insulin-Like Growth Factor I Receptor, NT (IGF-I Receptor, IGFIR, IGFR, Insulin-like Growth Factor 1 Receptor, IGF1R, CD221, JTK13, MGC18216, MGC142170, MGC142172) (FITC) discontinued
I7661-19M-FITC 200 µL

Insulin-Like Growth Factor I Receptor, NT (IGF-I Receptor, IGFIR, IGFR, Insulin-like Growth Factor 1 Receptor, IGF1R, CD221, JTK13, MGC18216, MGC142170, MGC142172) (FITC) discontinued

Sign In for Pricing
View Details
LUCA15 Polyclonal Antibody
MBS8523585-01 0.1 mg

LUCA15 Polyclonal Antibody

Sign In for Pricing
View Details