Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2CR12 Peptide - N-terminal region

ALS2CR12 Peptide - N-terminal region

Product Specifications

UniProt

Q96Q35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2CR12 Rabbit Polyclonal Antibody (orb325770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631902

Preservative

Lyophilized powder

AA Sequence

RWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNRDHQSAQKLLSSEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 / SRY-box 9 (rSOX9/2288), 0.2mg/mL
BNUB2288-500 1x 500 µL

SOX9 / SRY-box 9 (rSOX9/2288), 0.2mg/mL

Sign In for Pricing
View Details
TAC1 Mouse Monoclonal Antibody [Clone ID: SP-DE4-21]
AM02226PU-N 100 µg

TAC1 Mouse Monoclonal Antibody [Clone ID: SP-DE4-21]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS505179 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details
DZANK1 (NM_001099407) Human Over-expression Lysate
LC420444 20 µg

DZANK1 (NM_001099407) Human Over-expression Lysate

Sign In for Pricing
View Details
LYSMD1 Antibody
KC-3374-01 50 μL

LYSMD1 Antibody

Sign In for Pricing
View Details
LYSMD1 Antibody
KC-3374-02 100 µL

LYSMD1 Antibody

Sign In for Pricing
View Details