Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2CR12 Peptide - N-terminal region

ALS2CR12 Peptide - N-terminal region

Product Specifications

UniProt

Q96Q35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2CR12 Rabbit Polyclonal Antibody (orb325770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631902

Preservative

Lyophilized powder

AA Sequence

RWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNRDHQSAQKLLSSEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levomepromazine-D3 Sulfoxide
TRC-L375737-1MG 1 mg

Levomepromazine-D3 Sulfoxide

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF488A conjugate, 0.1mg/mL
BNC881152-500 1x 500 µL

IDH1 (IDH1/1152), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GluA4 Antibody
RC-15882-01 50 μL

Recombinant GluA4 Antibody

Sign In for Pricing
View Details
Recombinant GluA4 Antibody
RC-15882-02 100 µL

Recombinant GluA4 Antibody

Sign In for Pricing
View Details
Recombinant GluA4 Antibody
RC-15882-03 1 mL

Recombinant GluA4 Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[SK1]
AN00337C-01 20 Tests

FITC Anti-Human CD8 Antibody[SK1]

Sign In for Pricing
View Details