Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx1 Peptide - N-terminal region

Alx1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI314867, C130005I02, Cart1

UniProt

Q8C8B0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Alx1 Rabbit Polyclonal Antibody (orb578629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766141

Preservative

Lyophilized powder

AA Sequence

MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Anti-Human TACE (EC domain) protein IgG, aff pure
TACE12-M 100 µg

Mouse Monoclonal Anti-Human TACE (EC domain) protein IgG, aff pure

Sign In for Pricing
View Details
CDC123 protein (His tag)
80R-2803 100 ug

CDC123 protein (His tag)

Sign In for Pricing
View Details
ATXN7L1 (NM_152749) Human Tagged Lenti ORF Clone
RC206079L4 10 µg

ATXN7L1 (NM_152749) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal PDGF R alpha Antibody (16A1) [Alexa Fluor 700]
NBP1-44581AF700 0.1 mL

Mouse Monoclonal PDGF R alpha Antibody (16A1) [Alexa Fluor 700]

Sign In for Pricing
View Details
KRT17 Recombinant Protein (Human)
RP017347 100 µg

KRT17 Recombinant Protein (Human)

Sign In for Pricing
View Details
Cytochrome P450 2D6 Antibody
35268-01 50 µL

Cytochrome P450 2D6 Antibody

Sign In for Pricing
View Details