Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx1 Peptide - N-terminal region

Alx1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI314867, C130005I02, Cart1

UniProt

Q8C8B0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Alx1 Rabbit Polyclonal Antibody (orb578629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766141

Preservative

Lyophilized powder

AA Sequence

MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCB2P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
25047111 3x 1.0 µg

IQCB2P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
LOC100360889 3'UTR Luciferase Stable Cell Line
TU207753 1.0 mL

LOC100360889 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Purified human CD152 Antibody
orb3065044-01 100 µg

Purified human CD152 Antibody

Sign In for Pricing
View Details
Purified human CD152 Antibody
orb3065044-02 1 mg

Purified human CD152 Antibody

Sign In for Pricing
View Details
C-Kit Recombinant Rabbit Monoclonal Antibody (FITC)
orb2356029 100 µL

C-Kit Recombinant Rabbit Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
ACLY Antibody
CSB-PA001158GA01HU 100 µL

ACLY Antibody

Sign In for Pricing
View Details