Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMBN Peptide - C-terminal region

AMBN Peptide - C-terminal region

Product Specifications

UniProt

Q9NP70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMBN Rabbit Polyclonal Antibody (orb585041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057603

Preservative

Lyophilized powder

AA Sequence

RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Phospholipase C Like Protein 1 (PLCL1)
SIPD356Mu01-01 10 µg

Recombinant Phospholipase C Like Protein 1 (PLCL1)

Sign In for Pricing
View Details
Recombinant Phospholipase C Like Protein 1 (PLCL1)
SIPD356Mu01-02 50 µg

Recombinant Phospholipase C Like Protein 1 (PLCL1)

Sign In for Pricing
View Details
Recombinant Phospholipase C Like Protein 1 (PLCL1)
SIPD356Mu01-03 200 µg

Recombinant Phospholipase C Like Protein 1 (PLCL1)

Sign In for Pricing
View Details
Recombinant Phospholipase C Like Protein 1 (PLCL1)
SIPD356Mu01-04 1 mg

Recombinant Phospholipase C Like Protein 1 (PLCL1)

Sign In for Pricing
View Details
Recombinant Phospholipase C Like Protein 1 (PLCL1)
SIPD356Mu01-05 5 mg

Recombinant Phospholipase C Like Protein 1 (PLCL1)

Sign In for Pricing
View Details
PEX11C (PEX11G) Rabbit Polyclonal Antibody
TA331673 100 µL

PEX11C (PEX11G) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details