Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ambp Peptide - N-terminal region

Ambp Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ambp

UniProt

Q64240

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ambp Rabbit Polyclonal Antibody (orb578291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037033

Preservative

Lyophilized powder

AA Sequence

ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTATIP2 Polyclonal Antibody
E-AB-67708-01 60 µL

HTATIP2 Polyclonal Antibody

Sign In for Pricing
View Details
HTATIP2 Polyclonal Antibody
E-AB-67708-02 120 µL

HTATIP2 Polyclonal Antibody

Sign In for Pricing
View Details
HTATIP2 Polyclonal Antibody
E-AB-67708-03 200 µL

HTATIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant FGFR4 Antibody
RC-16920-01 50 μL

Recombinant FGFR4 Antibody

Sign In for Pricing
View Details
Recombinant FGFR4 Antibody
RC-16920-02 100 µL

Recombinant FGFR4 Antibody

Sign In for Pricing
View Details
Recombinant FGFR4 Antibody
RC-16920-03 1 mL

Recombinant FGFR4 Antibody

Sign In for Pricing
View Details