Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ambp Peptide - N-terminal region

Ambp Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ambp

UniProt

Q64240

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ambp Rabbit Polyclonal Antibody (orb578291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037033

Preservative

Lyophilized powder

AA Sequence

ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2,4-Dichlorophenyl)-oxirane
TRC-D475683-50MG 50 mg

2-(2,4-Dichlorophenyl)-oxirane

Sign In for Pricing
View Details
CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL
BNC403442-100 1x 100 µL

CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tex10 Mouse Gene Knockout Kit (CRISPR)
KN517425 1 Kit

Tex10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat F2 (Coagulation Factor II) CLIA Kit
E-CL-R0151-01 24 Tests

Rat F2 (Coagulation Factor II) CLIA Kit

Sign In for Pricing
View Details
Rat F2 (Coagulation Factor II) CLIA Kit
E-CL-R0151-02 48 Tests

Rat F2 (Coagulation Factor II) CLIA Kit

Sign In for Pricing
View Details
Rat F2 (Coagulation Factor II) CLIA Kit
E-CL-R0151-03 96 Tests

Rat F2 (Coagulation Factor II) CLIA Kit

Sign In for Pricing
View Details