Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amigo2 Peptide - middle region

Amigo2 Peptide - middle region

Product Specifications

Product Name Alternative

Ali1, Amigo2

UniProt

Q7TNJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Amigo2 Rabbit Polyclonal Antibody (orb582901) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877968

Preservative

Lyophilized powder

AA Sequence

FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paramyxovirus Parotitis, IgM, BioAssayTM ELISA Kit (Human) discontinued
227860-01 48 Tests

Paramyxovirus Parotitis, IgM, BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Paramyxovirus Parotitis, IgM, BioAssayTM ELISA Kit (Human) discontinued
227860-02 96 Tests

Paramyxovirus Parotitis, IgM, BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ATP6V1G1P6 Protein Vector (Human) (pPB-C-His)
PV064049 500 ng

ATP6V1G1P6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Hoxb7 shRNA (UAS) - Lentiviral mouse Hoxb7 shRNA (UAS, iRFP) (25)
GTR15263594 1 Vial

Lentiviral mouse Hoxb7 shRNA (UAS) - Lentiviral mouse Hoxb7 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZNF740 Rabbit Polyclonal Antibody (PE)
orb486265 100 µL

ZNF740 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CD94 (KLRD1, Killer cell lectin-like receptor, subfamily D, member 1, Kp43) (PE)
C2442-05C-PE 100 µL

CD94 (KLRD1, Killer cell lectin-like receptor, subfamily D, member 1, Kp43) (PE)

Sign In for Pricing
View Details