Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2B Peptide - N-terminal region

AMY2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMY2

UniProt

P19961

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2B Rabbit Polyclonal Antibody (orb585169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066188

Preservative

Lyophilized powder

AA Sequence

CGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL
BNC880823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF647 conjugate, 0.1mg/mL
BNC473085-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802D-01 20 Tests

PE Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
PE Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802D-02 100 Tests

PE Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
PE Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802D-03 2x 100 Tests

PE Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Ethyl Thiooxamate
TRC-E926850-1G 1 g

Ethyl Thiooxamate

Sign In for Pricing
View Details