Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2B Peptide - N-terminal region

AMY2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMY2

UniProt

P19961

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2B Rabbit Polyclonal Antibody (orb585169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066188

Preservative

Lyophilized powder

AA Sequence

CGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GAPT activation kit by CRISPRa
GA116418 1 Kit

Human GAPT activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Purified Antibody To Human Lambda Light Chain,  30nm
GAF-008-30 1 mL

Colloidal Gold Conjugated Goat Purified Antibody To Human Lambda Light Chain, 30nm

Sign In for Pricing
View Details
Recombinant Human VMO1 Protein (His Tag)
PKSH033217-01 10 µg

Recombinant Human VMO1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human VMO1 Protein (His Tag)
PKSH033217-02 50 µg

Recombinant Human VMO1 Protein (His Tag)

Sign In for Pricing
View Details
PE Anti-Mouse CD146 Antibody[ME-9F1]
E-AB-F1395D-01 50 Tests

PE Anti-Mouse CD146 Antibody[ME-9F1]

Sign In for Pricing
View Details
PE Anti-Mouse CD146 Antibody[ME-9F1]
E-AB-F1395D-02 100 Tests

PE Anti-Mouse CD146 Antibody[ME-9F1]

Sign In for Pricing
View Details