Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2B Peptide - C-terminal region

AMY2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMY2

UniProt

P19961

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2B Rabbit Polyclonal Antibody (orb585170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066188

Preservative

Lyophilized powder

AA Sequence

KWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Artery: carotid
CS808012 5x 5 µm

Tissue FFPE Sections, Artery: carotid

Sign In for Pricing
View Details
N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester
TRC-D430985-2.5MG 2.5 mg

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester

Sign In for Pricing
View Details
Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody
AP52467PU-N 400 µL

Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Actin ReguLatory Protein CAPG (CAPG) (NM_001747) Human Over-expression Lysate
LY419770 100 µg

Actin ReguLatory Protein CAPG (CAPG) (NM_001747) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 Rabbit Polyclonal Antibody
0805-4 100 µL

CD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant AATF Monoclonal Antibody
AN301423L-01 50 µL

Recombinant AATF Monoclonal Antibody

Sign In for Pricing
View Details