Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2B Peptide - C-terminal region

AMY2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMY2

UniProt

P19961

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2B Rabbit Polyclonal Antibody (orb585170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066188

Preservative

Lyophilized powder

AA Sequence

KWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromouridine-5'-Triphosphate (5-BrUTP), 10 mM in TE Buffer
#40026 1x 25 µL

5-Bromouridine-5'-Triphosphate (5-BrUTP), 10 mM in TE Buffer

Sign In for Pricing
View Details
2-(1,3-Benzothiazol-2-ylthio)succinic Acid
TRC-B130343-500MG 500 mg

2-(1,3-Benzothiazol-2-ylthio)succinic Acid

Sign In for Pricing
View Details
CHORDC1 Rabbit Polyclonal Antibody
TA361688 100 µL

CHORDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (R1), CF740 conjugate, 0.1mg/mL
BNC742845-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (R1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL
BNC942877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin-A Antibody
KC-3212-01 50 μL

Mammaglobin-A Antibody

Sign In for Pricing
View Details