Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL3 Peptide - N-terminal region

ANGPTL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ANGPT5, FHBL2

UniProt

Q9Y5C1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL3 Rabbit Polyclonal Antibody (orb330239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055310

Preservative

Lyophilized powder

AA Sequence

VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R3C siRNA (Mouse)
CRM6184-01 15 nmol

PPP2R3C siRNA (Mouse)

Sign In for Pricing
View Details
PPP2R3C siRNA (Mouse)
CRM6184-02 30 nmol

PPP2R3C siRNA (Mouse)

Sign In for Pricing
View Details
HDAC7 (Histone Deacetylase 7, HD7A, HDAC7A) (PE)
MBS6420104-01 0.1 mL

HDAC7 (Histone Deacetylase 7, HD7A, HDAC7A) (PE)

Sign In for Pricing
View Details
HDAC7 (Histone Deacetylase 7, HD7A, HDAC7A) (PE)
MBS6420104-02 5x 0.1 mL

HDAC7 (Histone Deacetylase 7, HD7A, HDAC7A) (PE)

Sign In for Pricing
View Details
Rabbit Monoclonal PSGL-1/CD162 Antibody (PSGL1/8192R) [Allophycocyanin]
NBP3-20932APC 0.1 mL

Rabbit Monoclonal PSGL-1/CD162 Antibody (PSGL1/8192R) [Allophycocyanin]

Sign In for Pricing
View Details
OFDYP7 sgRNA CRISPR Lentivector set (Human)
K1478801 3x 1.0 µg

OFDYP7 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details