Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Peptide - middle region

ANGPTL7 Peptide - middle region

Product Specifications

Product Name Alternative

AngX, CDT6, RP4-647M16.2, dJ647M16.1

UniProt

O43827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL7 Rabbit Polyclonal Antibody (orb580796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066969

Preservative

Lyophilized powder

AA Sequence

NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT2B (NM_001167971) Human Over-expression Lysate
LC433120 20 µg

TRMT2B (NM_001167971) Human Over-expression Lysate

Sign In for Pricing
View Details
GAPDHS (NM_014364) Human Over-expression Lysate
LY402320 100 µg

GAPDHS (NM_014364) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565741 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), Biotin conjugate, 0.1mg/mL
BNCB1727-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mrps16 activation kit by CRISPRa
GA206658 1 Kit

Mouse Mrps16 activation kit by CRISPRa

Sign In for Pricing
View Details
Oxolinic Acid-d5
TRC-O857502-1MG 1 mg

Oxolinic Acid-d5

Sign In for Pricing
View Details