Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Peptide - middle region

ANGPTL7 Peptide - middle region

Product Specifications

Product Name Alternative

AngX, CDT6, RP4-647M16.2, dJ647M16.1

UniProt

O43827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL7 Rabbit Polyclonal Antibody (orb580796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066969

Preservative

Lyophilized powder

AA Sequence

NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR2AP1 activation kit by CRISPRa
GA114734 1 Kit

Human OR2AP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Fetuin-A Protein (His Tag)
PDMM100228-01 20 µg

Recombinant Mouse Fetuin-A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin-A Protein (His Tag)
PDMM100228-02 100 µg

Recombinant Mouse Fetuin-A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin-A Protein (His Tag)
PDMM100228-03 500 µg

Recombinant Mouse Fetuin-A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Fetuin-A Protein (His Tag)
PDMM100228-04 1 mg

Recombinant Mouse Fetuin-A Protein (His Tag)

Sign In for Pricing
View Details
Human BCL2L12 activation kit by CRISPRa
GA113209 1 Kit

Human BCL2L12 activation kit by CRISPRa

Sign In for Pricing
View Details