Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKMY2 Peptide - N-terminal region

ANKMY2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZP564O043, ZMYND20

UniProt

Q8IV38

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKMY2 Rabbit Polyclonal Antibody (orb583543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064715

Preservative

Lyophilized powder

AA Sequence

DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SETD1A Monoclonal Antibody
AN301557L-01 50 µL

Recombinant SETD1A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SETD1A Monoclonal Antibody
AN301557L-02 100 µL

Recombinant SETD1A Monoclonal Antibody

Sign In for Pricing
View Details
Human Peptidase inhibitor 16 (PI16) activation kit by CRISPRa
GA116622 1 Kit

Human Peptidase inhibitor 16 (PI16) activation kit by CRISPRa

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2744), CF647 conjugate, 0.1mg/mL
BNC472744-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2744), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSPBP1 (NM_001130106) Human Over-expression Lysate
LY427167 100 µg

HSPBP1 (NM_001130106) Human Over-expression Lysate

Sign In for Pricing
View Details
GCNT3 Antibody
8C14708-AAT 50 µg

GCNT3 Antibody

Sign In for Pricing
View Details