Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD13D Peptide - middle region

ANKRD13D Peptide - middle region

Product Specifications

Product Name Alternative

MGC50828

UniProt

Q6ZTN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD13D Rabbit Polyclonal Antibody (orb582972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997237

Preservative

Lyophilized powder

AA Sequence

ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MYBPC3 Antibody (3A577)
TMAB-09136-01 25 µL

Anti-MYBPC3 Antibody (3A577)

Sign In for Pricing
View Details
Anti-MYBPC3 Antibody (3A577)
TMAB-09136-02 50 μL

Anti-MYBPC3 Antibody (3A577)

Sign In for Pricing
View Details
Anti-MYBPC3 Antibody (3A577)
TMAB-09136-03 100 µL

Anti-MYBPC3 Antibody (3A577)

Sign In for Pricing
View Details
Microcystin LR (FITC) discontinued
M3889-25B-FITC 100 µL

Microcystin LR (FITC) discontinued

Sign In for Pricing
View Details
5-Chloro-3- (3-methylphenyl) -1,2,4-thiadiazole
WYB34238-01 100 mg

5-Chloro-3- (3-methylphenyl) -1,2,4-thiadiazole

Sign In for Pricing
View Details
5-Chloro-3- (3-methylphenyl) -1,2,4-thiadiazole
WYB34238-02 1 g

5-Chloro-3- (3-methylphenyl) -1,2,4-thiadiazole

Sign In for Pricing
View Details