Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLF1 Peptide - N-terminal region

SLF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCTx, BRCTD1, ANKRD32

UniProt

Q9BQI6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLF1 Rabbit Polyclonal Antibody (orb584670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115666

Preservative

Lyophilized powder

AA Sequence

TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leukotriene A4 Hydrolase Antibody
KC-3325-01 50 μL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Leukotriene A4 Hydrolase Antibody
KC-3325-02 100 µL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Leukotriene A4 Hydrolase Antibody
KC-3325-03 1 mL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
OR2K2 Antibody
8G555-AAT 50 µg

OR2K2 Antibody

Sign In for Pricing
View Details
METTL2A Antibody
KC-8190-01 50 μL

METTL2A Antibody

Sign In for Pricing
View Details
METTL2A Antibody
KC-8190-02 100 µL

METTL2A Antibody

Sign In for Pricing
View Details