Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLF1 Peptide - N-terminal region

SLF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCTx, BRCTD1, ANKRD32

UniProt

Q9BQI6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLF1 Rabbit Polyclonal Antibody (orb584670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115666

Preservative

Lyophilized powder

AA Sequence

TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA (FOLH1) Rabbit Polyclonal Antibody
TA371255 100 µL

PSMA (FOLH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse VCAM1 Recombinant Rabbit monoclonal Antibody
HA723829 100 µL

Mouse VCAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD15 / FUT4 (Reed-Sternberg Cell Marker), CF594 conjugate, 0.1mg/mL
BNC941649-500 1x 500 µL

CD15 / FUT4 (Reed-Sternberg Cell Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c-Myb (MYB) (NM_001161657) Human Over-expression Lysate
LY431477 100 µg

c-Myb (MYB) (NM_001161657) Human Over-expression Lysate

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL
BNC472448-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEKK2 (MAP3K2) Human Knockdown Lysate
LY300503 100 µg

MEKK2 (MAP3K2) Human Knockdown Lysate

Sign In for Pricing
View Details