Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD5 Peptide - N-terminal region

ANKRD5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ21669, dJ839B4.6, ANKRD5

UniProt

Q9NU02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD5 Rabbit Polyclonal Antibody (orb583627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071379

Preservative

Lyophilized powder

AA Sequence

MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF594 conjugate, 0.1mg/mL
BNC942446-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATG12 Rabbit Polyclonal Antibody
R1404-1 100 µL

ATG12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diethyl Disulfide
TRC-D444315-25G 25 g

Diethyl Disulfide

Sign In for Pricing
View Details
Atg7 Mouse Gene Knockout Kit (CRISPR)
KN301741 1 Kit

Atg7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Medazepam-13C,d3 Hydrochloride
TRC-M203152-1MG 1 mg

Medazepam-13C,d3 Hydrochloride

Sign In for Pricing
View Details
Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]
TA503821AM 100 µL

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]

Sign In for Pricing
View Details