ANKRD5 Peptide - N-terminal region
ANKRD5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ21669, dJ839B4.6, ANKRD5
UniProt
Q9NU02
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD5 Rabbit Polyclonal Antibody (orb583627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071379
Preservative
Lyophilized powder
AA Sequence
MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BTG2 Mouse Monoclonal Antibody [Clone ID: OTI4H8]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9082b6/imageurl/cf808268.webp)
TP303823M 100 µg
KChIP2 (KCNIP2) (NM_173192) Human Recombinant Protein
Sign In for Pricing
View Details 
RG239267 10 µg
GCP4 (TUBGCP4) (NM_001286414) Human Tagged ORF Clone
Sign In for Pricing
View Details 
![CRBN Recombinant Rabbit Monoclonal Antibody [PSH0-70]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea813de/imageurl/ha721458.webp)
HA721458 100 µL
CRBN Recombinant Rabbit Monoclonal Antibody [PSH0-70]
Sign In for Pricing
View Details 